PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0042s0570.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 508aa    MW: 57194.8 Da    PI: 7.7327
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0042s0570.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-19761357
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            kRt  t+ q+++Le+++++++yp++e++ eLA+++gLte+q++ WF+ rR k+k+
  SapurV1A.0042s0570.3.p  7 KRTVKTPAQVDALENFYNEHKYPTEEMKSELADQIGLTEKQISSWFCHRRLKDKR 61
                            8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.2262IPR001356Homeobox domain
SuperFamilySSF466891.15E-17466IPR009057Homeodomain-like
SMARTSM003891.1E-19466IPR001356Homeobox domain
CDDcd000861.61E-18761No hitNo description
Gene3DG3DSA:1.10.10.602.5E-21761IPR009057Homeodomain-like
PfamPF000463.4E-17761IPR001356Homeobox domain
PROSITE patternPS0002703760IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MEDKNFKRTV KTPAQVDALE NFYNEHKYPT EEMKSELADQ IGLTEKQISS WFCHRRLKDK  60
RLRDEGCTNG RQDRSSGIIQ DRGSGLRQDS CGSTKQGDYR NLDPREVESQ RPYGQNFHTA  120
DLTYDRTSRY TGHDSSIDNI SSGSSSSLQD KFVSQREDPY DAENSKYLAQ NEAAMPLIPK  180
GADSFGYKPS GYLKVKGEIE NAAITAVKMQ LGRHYKEDGP PLGVEFQPLP PGAFASPSRD  240
PANGPIYVGD LARMCSPDVS GVRKQSSLGT RYEVYGTKMS SHDSYTEGAN CNPEHSDSHD  300
KKSHHHLEQK PTYNGSNSNA GGNSAMDMPD DLAGETSAYV NKRHYRMSSK HGFEGRRLDS  360
LSTHHGPSGR RNSEKTEAWL YDCNNDNPKI VQRNNYMSKH PHLMRGFGKS LDTEERAPRT  420
ITEKEDKLYG EMKRMKAFHD PVRVRRHPTD ESTVAKRFRV DFPQQEYVAK ASFSERHRRT  480
NLTKGSAMER PSSFSEDEAA ETSSSAE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313994.20.0hypothetical protein POPTR_0009s07600g
TrEMBLB9HNF30.0B9HNF3_POPTR; Uncharacterized protein
STRINGPOPTR_0009s07600.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.12e-85HB-other family protein